Tesamorelin

February 26, 2019
SKU: 218949-48-5

Phcoker is a professional Tesamorelin GMP manufacturer that provide both form of Tesamorelin powder and Tesamorelin finished lyophilized powder in vial.  The regularly manufacturing specification include Tesamorelin 5mg, Tesamorelin 10mg, Tesamorelin 15mg. Larger dosage and contract manufacturing service is available.

Monthly production capacity: >1,000,000 vials


Other Name:Egrifta SV,tesamorelin,TH-9507,TH9507

 

Request a Quick Quote

Raw Tesamorelin powder (218949-48-5) video

 

Properties


Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula:C221H366N72O67S
Molecular Weight:5136 g/mol
PubChem CID:16137828
CAS Number:218949-48-5
Synonyms:Egrifta SV,tesamorelin,TH-9507,TH9507

Description


Tesamorelin peptide is a synthetic analog of growth hormone releasing hormone. Tesamorelin injection is a hormone similar to that released by the hypothalamus and is primarily used to treat abdominal and stomach fat caused by human immunodeficiency virus infection. Tesamorelin peptide was first approved by the FDA in 2010 and is marketed under the trade name Egrifta SV. Studies have shown that Tesamorelin can reduce visceral fat in patients by 20%. Here is the complete guide of Tesamorelin peptide in 2024.

The Structure Of Tesamorelin

Structure Tesamorelin

What Is Tesamorelin Peptide

Tesamorelin is a synthetic compound based on the N-terminus of a 44-amino acid sequence of GHRH. It works by binding to and stimulating GHRH levels in the pituitary gland.[2][6]In the case of Tesamorelin, it is composed of a series of compounds that mimic natural GHRH. The amino acid sequence of the hormone.

Lipodystrophy is a metabolic disease characterized by hyperlipidemia, insulin resistance, and fat redistribution. Tesamorelin can have a significant impact on glucose and lipid metabolism through subcutaneous injection. It is suitable for treating visceral obesity caused by human immunodeficiency virus (HIV) and is suitable for reducing abdominal fat in HIV patients.

Tesamorelin, a synthetic analog of growth hormone-releasing hormone, stimulates the pituitary gland to produce and release growth hormone, which has an improved effect on the redistribution of body fat.[1][5]

Research on Tesamorelin mainly focuses on Tesamorelin’s benefits, side effects, etc. Researchers seeking Tesamorelin for research purpose found that many peptide manufacturers supply different form Tesamorelin in the market, among of the different form of Tesamorelin, the Tesamorelin powder and Tesamorelin injection are best sale with different brand name. Compare Tesamorelin price is important, but the challenge is to find out a good Tesamorelin manufacturer.

How Dose Tesamorelin Peptide Work?

Tesamorelin peptide is a synthetic peptide. Like the natural growth hormone-releasing hormone produced by the hypothalamus, this synthetic peptide can stimulate the pituitary gland to secrete and release growth hormone. The release of growth hormone promotes the breakdown of fat. [3][9][10]Tesamorelin powder is the active ingredient of Tesamorelin-base drug which works by reducing visceral fat. When Tesamorelin is injected, it acts as a GHRH receptor agonist, which results in more growth hormone release.

Increased growth hormone levels can have many effects on the body:

  • Redistribute fat: The biggest benefit of Tesamorelin is the reduction of visceral fat tissue, which can improve lipodystrophy-related diseases in AIDS.
  • Regulate metabolism:Stimulating the pituitary gland can increase the level of growth hormone in the blood. Growth hormone can improve insulin sensitivity and blood lipid status, and can regulate metabolism.
  • Promote muscle growth and recovery:Muscle growth and repair are closely related to growth hormone levels. Although Tesamorelin’s main function is not to strengthen muscles, it will stimulate the secretion of growth hormone, which is also beneficial to muscle growth.

What Can Tesamorelin Powder Do For YouBenefits Of Tesamorelin

Tesamore powder is a synthetic peptide that stimulates the secretion and release of hormones produced in the body. [4][11]It can bring many benefits to the body:

Reduce visceral fat tissue

Tesamorelin works by increasing growth hormone levels, causing fat stored in the body to break down into fatty acids, thereby converting them into fuel for body energy. Tesamorelin burns fat around abdominal organs but not subcutaneous fat tissue.

Stimulate growth hormone secretion

Growth hormone decreases with age. By stimulating the secretion and release of growth hormone from the pituitary gland, Tesamorelin can restore growth hormone levels to normal levels.[7][12]

Improve cognitive abilities

Studies have shown that Tesamorelin can restore growth hormone to normal levels, which is beneficial to improving mental ability, thereby helping the elderly and people with mild cognitive impairment improve concentration and memory.

Restore peripheral nerve loss

Peripheral nerve damage caused by surgery, diabetes and other diseases can lead to loss of movement and sensory abilities. Tesamorelin can improve nerve regeneration, showing its potential role as a treatment for peripheral nerve loss.

Gain muscle

Tesamorelin restores muscle strength in patients with growth hormone deficiency. As a GHRH analog, Tesamorelin increases and normalizes lean muscle mass.

Tesamorelin is very popular in the fitness field and among people who lose weight. You can buy Tesamorelin at pharmacies with a prescription, but many people also buy Tesamorelin powder or injection online because it is cheaper and the shipping time is fast, such as you can receive Tesamorelin injection and powder from Phcoker within 3 days in United States.

What Are The Uses Of Tesamorelin Powder For Bodybuilders?

IGF-1 is a hormone naturally produced in the liver and plays a very important role in the growth and development of the body and the maintenance of tissues and organs. IGF-1 can promote the growth of new and old muscles. Increased IGF-1 hormone levels can promote muscle growth and increase muscle strength. [8][15]In addition, IGF-1 has been proven to shorten the recovery time of sports injuries, and has therefore been favored by many bodybuilders.

Tesamorelin powder is the active ingredient of Tesamorein injection or Tesamorelin-based pharmaceutical drugs. Tesamorelin is FDA-approved drug that can help HIV patients deal with excess abdominal fat accumulation. Tesamorelin can stimulate the release of growth hormone and increase the level of IGF-1, which is needed by bodybuilders to help them reduce muscle breakdown, reduce inflammation caused by toxins, and promote muscle growth.

Although Testosterone, Trenbolone, Nandrolone and other steroid products are the most widely used in the fitness field, but unlike these steroid products, Tesamorelin is a peptide that has much fewer side effects than steroid powder. If you are in weight management, Tesamorelin peptide may be help.

Will Tesamorelin Help With Muscle Growth?

Researchers studied participants with two different medical conditions in a clinical trial.

First, the researchers found that the density, area, and mass of skeletal muscles in HIV patients increased after injections of Tesamorelin.[13][14]In addition, the researchers also found that the experimenters had a significant reduction in abdominal fat.

Secondly, they also studied patients with chronic obstructive pulmonary disease who increased their lean muscle mass after receiving Tesamorelin, which is very important for improving the patient’s physical strength and function.

These findings suggest that Tesamorelin can increase muscle mass and improve body composition in patients. This is why many fitness enthusiasts buy Tesamorelin online. Good Tesamorelin peptide manufacturers has a production environment that fully complies with GMP conditions and a strict quality management system, and can provide product-related professional test reports such as COA, HPLC, MS…

What Are The Side Effects Of Tesamorelin Peptide?

Professional peptide manufacturer Phcoker can provide you with high-quality Tesamorelin powder which is the active ingredient of Tesamorelin injection or other Tesamorelin form. Although this drug has been approved by the FDA, you should also be aware of its possible side effects before using it.

Common side effects

Redness and pain at the injection site

bad habits

Muscle pain

sweating

diarrhea

Uncommon side effects

Headache

Weakness in limbs

Irregular heart rate

Tingling in limbs

Chest pain

blurred vision

But it’s worth noting that these side effects will gradually disappear after you get used to Tesamorelin. If they worsen, you need to consult your health care provider in time.

Tesamorelin For Sale | Tesamorelin Supplier

One of Tesamorelin’s primary uses is to reduce visceral fat accumulation, making it a promising treatment option especially for patients with HIV-related lipodystrophy. By stimulating the release of growth hormone, Tesamorelin promotes the breakdown of adipose tissue and inhibits fat production.

Although there are many studies showing the benefits of Tesamorelin, more research is needed to understand Tesamorelin’s clinical effects. There are many peptide suppliers on the market now. If you want to buy Tesamorelin online, please make sure you buy it from a reliable peptide supplier. Phcoker is a new trusted Tesamorelin manufacturer that can provide you with pharmaceutical grade Tesamorelin injection.

 

Manufacturers/Factory


Tesamorelin is a synthetic growth hormone-releasing hormone analog that works by stimulating the pituitary gland to produce and release growth hormone, which aids in the redistribution of body fat. For the treatment of visceral obesity in HIV-infected patients with lipodystrophy. Subcutaneous injection of tesamorelin produced significant effects on glucose and lipid metabolism but was not associated with elevated serum aminotransferases or significant acute liver injury during treatment.

As the best Tesamorelin peptide manufacturer, Phcoker is not only supply the peptide Tesamorelin in powder form but provide the customized standard easy use vial form.You can purchase Tesamorelin 5mg at Phcoker.com, but we also support customization services and can customize your unique product specifications, colors, bottle sizes, etc.

You can buy the best price of Tesamorelin injection and best quality peptide from this professional peptide manufacturer.

 

Where to buy


Would you like to buy the best Tesamorelin peptide from the best Tesamorelin suppliers in the market? You have come at the right place!

Phcoker as a peptide factory, is the best place where you can buy Tesamorelin in compeptitive price, from small to bulk quantity. Click and make a contact, you will get all the details. Before buy Tesamorelin, you may curious:

What Are The Advantages If Buy Tesamorelin From Phcoker.com?

  • 【Competitive Factory Price】

Factory direct sales, No middlemen make a difference.

  • 【Customization Service】

Product specifications can be customized to create your own peptide brand.

  • 【Quality Guarantee】

Professional lab reports along with shipment.

  • 【Fast Shipping】

Professional logistics customization solutions, on-time delivery.

  • 【Easy Payment】

Payment methods that are diverse.

  • 【365/24/7 Service】

High quality pre-sales and after-sales service, followed by product and order details consultation.

How To Get The Quick Price Of Tesamorelin Online?

  • Visit professional Tesamorelin supplier Phcoker.com, choose the Tesamorelin you want to buy.
  • Leave your contact and message on Phcoker website, then submit to Phcoker.com.
  • The customer service will reply you in 12 hours once received your message, then talk in details about buy Tesamorelin.

Does Phcoker.com Support The Free Sample Of Tesamorelin Powder?

It depends, different products with different policy, please check it with our customer service. Most of products can be accepted for sample.

Can I Appoint The Tesamorelin Colour When Buy Tesamorelin?

YES! Phcoker as peptide manufacturer, provide colour customization of Tesamorelin, easy to help you to build your Tesamorelin peptide brand.

Can I Appoint The Products Standard When Buy Tesamorelin From Phcoker.com?

YES! As one of the best Tesamorelin manufacturer, Phcoker not only provide the standard specification of Tesamorelin in 5mg, 10mg, but support standard customization. Provide the best support to build your own Tesamorelin brand.

Can I Buy Tesamorelin In Pure Powder Form From Phcoker.com?

YES! Tesamorelin powder is the base that use for Tesamorelin lyophilized powder manufacture. Phcoker provide Tesamorelin in both of pure powder form and semi-finished vial form.

Can I Buy Discount Tesamorelin Powder From Phcoker.com?

YES! Our factory produce high quality Tesamorelin powder in term and keep Tesamorelin powder in stock. You can buy high quality Tesamorelin powder in bulk. During promotion sale, you can buy Tesamorelin peptide by lower price. You can keep touch with our customer manager and they will update the latest bulk Tesamorelin price for you in time.

 

FAQ


What is Tesamorelin used for?

Tesamorelin can help adults with HIV and lipodystrophy reduce excess fat in their abdominal organs.

What effect does Tesamorelin have on fitness?

Tesamorelin can stimulate the growth of skeletal muscles after injection, thereby increasing the quantity and quality of muscle groups, in addition to increasing muscle density.

Is Tesamorelin a steroid?

No, Tesamorelin is not a steroid but a synthetic peptide, a growth hormone analog that reduces visceral fat in the abdominal area.

Is Tesamorelin a growth hormone?

Tesamorelin is an FDA-approved synthetic version of the natural hormone growth hormone-releasing hormone that promotes the release of growth hormone.

Is Tesamorelin legal?

Tesamorelin was approved by the FDA in 2010 and is one of the best weight loss treatments.

Is Tesamorelin effective?

Tesamorelin is effective in promoting weight loss, and it can also help improve patients’ cognitive abilities and mental health.

How long does it take for Tesamorelin to work?

Studies have shown that patients treated with Tesamorelin were able to significantly reduce visceral fat and improve blood lipids at 26 weeks.

How often should I get Tesamorelin injections?

You should ask your doctor before injecting Tesamorelin. Generally speaking, Tesamorelin should be injected subcutaneously once a day to ensure its effectiveness.

Who should take Tesamorelin?

As a synthetic growth hormone-releasing hormone analog, it can treat visceral fat in HIV-infected patients with lipodystrophy.

How should Tesamorelin be stored?

Your Tesamorelin injection should be kept refrigerated, but not frozen.

 

Referenced Citations


[1]”Egrifta (tesamorelin for injection) for Subcutaneous Use. U.S. Full Prescribing Information” (PDF). EMD Serono, Inc. Archived from the original (PDF) on 18 December 2011. Retrieved 9 April 2016.

[2] “FDA Application Chemistry Review” (PDF).

[3]Dhillon S (May 2011). “Tesamorelin: a review of its use in the management of HIV-associated lipodystrophy”. Drugs. 71 (8): 1071–1091. doi:10.2165/11202240-000000000-00000. PMID 21668043. S2CID 195681455.

[4]Ferdinandi ES, Brazeau P, High K, Procter B, Fennell S, Dubreuil P (January 2007). “Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue“. Basic & Clinical Pharmacology & Toxicology. 100 (1): 49–58. doi:10.1111/j.1742-7843.2007.00008.x. PMID 17214611.

[5]Benedini S, Terruzzi I, Lazzarin A, Luzi L (2008). “Recombinant human growth hormone: rationale for use in the treatment of HIV-associated lipodystrophy“. BioDrugs. 22 (2): 101–112. doi:10.2165/00063030-200822020-00003. PMID 18345707. S2CID 34340539.

[6]Patel A, Gandhi H, Upaganlawar A (April 2011). “Tesamorelin: A hope for ART-induced lipodystrophy“. Journal of Pharmacy & Bioallied Sciences. 3 (2): 319–320. doi:10.4103/0975-7406.80763. PMC 3103937. PMID 21687371.

[7]DeRuiter J, Holston PL. “Review of Selected NMEs 2011“. www.uspharmacist.com. Auburn: Health Information Designs, Inc. Retrieved 2019-06-22.

[8]Falutz J, Potvin D, Mamputu JC, Assaad H, Zoltowska M, Michaud SE, et al. (March 2010). “Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension“. Journal of Acquired Immune Deficiency Syndromes. 53 (3): 311–322. doi:10.1097/qai.0b013e3181cbdaff. PMID 20101189. S2CID 13613924.

[9]Falutz J, Allas S, Kotler D, Thompson M, Koutkia P, Albu J, Trottier B, et al. A placebo controlled, dose ranging study of a growth hormone releasing factor in HIV infected patients with abdominal fat accumulation. AIDS 2005; 19: 1279-87.

[10]Falutz J, Allas S, Blot K, Potvin D, Kotler D, Somero M, Berger D, et al. Metabolic effects of a growth hormone releasing factor in patients with HIV. N Engl J Med 2007; 357: 2359 70.

[11]Grunfeld C, Dritselis A, Kirkpatrick P. Tesamorelin. Nat Rev Drug Discov 2011; 10: 95 6.

[12]Makimura H, Feldpausch MN, Rope AM, Hemphill LC, Torriani M, Lee H, Grinspoon SK. Metabolic effects of a growth hormone releasing factor in obese subjects with reduced growth hormone secretion: a randomized controlled trial. J Clin Endocrinol Metab 2012; 97: 4769 79.

[13]Stanley TL, Falutz J, Marsolais C, Morin J, Soulban G, Mamputu JC, Assaad H, et al. Reduction in visceral adiposity is associated with an improved metabolic profile in HIV infected patients receiving tesamorelin. Clin Infect Dis 2012; 54: 1642 51.

[14]Spooner LM, Olin JL. Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy. Ann Pharmacother 2012; 46: 240-7.

[15]Clemmons DR, Miller S, Mamputu JC. Safety and metabolic effects of tesamorelin, a growth hormone releasing factor analogue, in patients with type 2 diabetes: A randomized, placebo controlled trial. PLoS One 2017; 12: e0179538.

 

Author of this article:


Dr. Jean Zeng graduated from king’s college london Faculty of Life Sciences & Medicine.

 

Scientific Journal paper Author:


1.Takara L Stanley MD

Metabolism Unit, Massachusetts General Hospital and Harvard Medical School, Boston, MA, USA

2.Jennifer Audsley

The Peter Doherty Institute for Infection and Immunity, The University of Melbourne and Royal Melbourne Hospital, Melbourne, VIC 3000, Australia

3.K. Azimpour

Purple Squirrel Economics, Montreal, QC, Canada

4.Laura Baker

University of Washington School of Medicine/VAPSHCS, Seattle, Wash., United States

5.Laurie R. Braun

Program in Nutritional Metabolism and Neuroendocrine Unit, Massachusetts General Hospital and Harvard Medical School, Boston, MA, United States

 

Contact Us


Polypeptide Peptide dosage calculator